Overview

  • Product name

    Recombinant Human T Plastin/PLS3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFDEMATTQISKDELDELKEAFA KVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKI SFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYS EEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINL SVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAG KPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEEL LLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRID INMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVAN LFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYAD LQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKH PAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDD IIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLV KSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACL MGRGMKRV
    • Molecular weight

      74 kDa including tags
    • Amino acids

      2 to 630
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      T7-His-TEV cleavage site tag (29aa) at N-terminus (NP_005023).

Specifications

Our Abpromise guarantee covers the use of ab211933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab211933 was expressed in E.coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as T Plastin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose, and DTT.

General Info

  • Alternative names

    • BMND18
    • Plastin 3
    • Plastin 3 (T isoform)
    • Plastin-3
    • PLS3
    • PLST_HUMAN
    • T fimbrin
    • T-plastin
    see all
  • Function

    Actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia.
  • Tissue specificity

    Expressed in a variety of organs, including muscle, brain, uterus and esophagus.
  • Sequence similarities

    Contains 2 actin-binding domains.
    Contains 4 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab211933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up