Description

  • Product name

    Recombinant Human TAB1 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.
    ab185586 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAQRRSLLQSEQQPSWTDDLP LCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYD GNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESID DALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAV LLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLG LDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEI HGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTS LDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEM SQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAH SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPP GEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      1 to 504
    • Additional sequence information

      Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • 2310012M03Rik
    • 3'-Tab1
    • MAP3K7IP 1
    • MAP3K7IP1
    • MGC57664
    • Mitogen activated protein kinase kinase kinase 7 interacting protein 1
    • Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
    • TAB 1
    • TAB1
    • TAB1_HUMAN
    • TAK1 binding protein 1
    • TAK1-binding protein 1
    • TGF beta activated kinase 1 binding protein 1
    • TGF-beta activated kinase 1/MAP3K7 binding protein 1
    • TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
    • TGF-beta-activated kinase 1-binding protein 1
    • Transforming growth factor beta activated kinase binding protein 1
    see all
  • Function

    May be an important signaling intermediate between TGFB receptors and MAP3K7/TAK1. May play an important role in mammalian embryogenesis.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 PP2C-like domain.
  • Post-translational
    modifications

    Monoubiquitinated. Deubiquitinated by Y.enterocolitica YopP.
  • Information by UniProt

References

ab185586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up