Description

  • Product name

    Recombinant Human TAB2 protein (His tag)
    See all TAB2 proteins and peptides
  • Purity

    85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTFL NHPALIRCEQ CEMPRHF
    • Predicted molecular weight

      8 kDa including tags
    • Amino acids

      627 to 693
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab207975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab207975 can be used for in vitro pulldown assays and for enrichment of cellular proteins conjugated with lysine 63 polyubiquitin chains in whole cell or tissue lysates. ab207975 can be precipitated using Nickel resin. After washing, ab207975 and its bound proteins can be eluted by a buffer containing 200 mM imidazole.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • CHTD2
    • FLJ21885
    • KIAA0733
    • MAP3K7IP2
    • Mitogen activated protein kinase kinase kinase 7 interacting protein 2
    • Mitogen-activated protein kinase kinase kinase 7-interacting protein 2
    • OTTHUMP00000040125
    • TAB 2
    • TAB-2
    • Tab2
    • TAB2_HUMAN
    • TAK1 binding protein 2
    • TAK1-binding protein 2
    • TGF beta activated kinase 1/MAP3K7 binding protein 2
    • TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
    • TGF-beta-activated kinase 1-binding protein 2
    see all
  • Function

    Adapter linking MAP3K7/TAK1 and TRAF6. Promotes MAP3K7 activation in the IL1 signaling pathway. The binding of 'Lys-63'-linked polyubiquitin chains to TAB2 promotes autophosphorylation of MAP3K7 at 'Thr-187'. Involved in heart development.
  • Tissue specificity

    Widely expressed. In the embryo, expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves.
  • Involvement in disease

    Defects in TAB2 are the cause of congenital heart disease non-syndromic type 2 (CHTD2) [MIM:612863]. It is a disease characterized by congenital developmental abnormalities involving structures of the heart. Clinical features include left ventricular outflow tract obstruction, subaortic stenosis, residual aortic regurgitation, atrial fibrillation, bicuspid aortic valve and aortic dilation. Note=A chromosomal aberration involving TAB2 has been found in a family with congenital heart disease. Translocation t(2;6)(q21;q25).
  • Sequence similarities

    Contains 1 CUE domain.
    Contains 1 RanBP2-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated; following IL1 stimulation or TRAF6 overexpression. Ubiquitination involves RBCK1 leading to proteasomal degradation.
    Phosphorylated.
  • Cellular localization

    Membrane. Cytoplasm > cytosol. Following IL1 stimulation, translocation occurs from the membrane to cytosol.
  • Information by UniProt

Images

  • Coomassie-stained SDS-PAGE analysis of 5 µg purified ab207975

References

ab207975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up