Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLEL ETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGK PKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDA PNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRW AQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQ PEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPR NQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQ AELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMA ARQKKRTPTKKEKDQAWKTLKERESILKLLDG
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 432

Specifications

Our Abpromise guarantee covers the use of ab132493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADA3
    • ADA3 homolog
    • ADA3-like protein
    • FLJ20221
    • FLJ21329
    • hADA3
    • Transcriptional adaptor 3 (NGG1 homolog yeast) like
    • Transcriptional adaptor 3 like
    see all
  • Relevance

    TADA3L functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. TADA3L is also known as a coactivator for p53/TP53-dependent transcriptional activation. The PCAF complex is composed of a number of TBP-associated factors (TAFS), such as TAF5, TAF5L, TAF6, TAF6L, TAF9, TAF10 and TAF12, PCAF, and also PCAF-associated factors (PAFs), such as TADA2L/ADA2, TADA3L/ADA3 and SPT3.
  • Cellular localization

    Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab132493 stained with Coomassie Blue.

References

ab132493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up