Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDF AQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW KLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGML KDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSK LDKDDYAYNAVAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFY GDRDGAQEVLTNYAYDEKFPSNPNAHIYLYNFLKRQKAPRSKLISVLKIL YQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALA CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
    • Amino acids
      1 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC:17061
    • RAFI48
    • RNA polymerase I-specific TBP-associated factor 48 kDa
    • SL1
    • SL1 48kD subunit
    • Taf1a
    • TAF1A_HUMAN
    • TAFI48
    • TATA box binding protein (TBP) associated factor RNA polymerase I, A 48kDa
    • TATA box binding protein (Tbp)-associated factor, RNA polymerase I, A
    • TATA box binding protein associated factor 1A
    • TATA box binding protein associated factor RNA polymerase I subunit A
    • TATA box-binding protein-associated factor 1A
    • TATA box-binding protein-associated factor RNA polymerase I subunit A
    • TBP associated factor RNA polymerase I 48 kDa
    • TBP-associated factor 1A
    • Transcription factor SL1
    • Transcription initiation factor SL1/TIF-IB subunit A
    see all
  • Function
    Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up