Description

  • Product name

    Recombinant Human TAF1 protein
    See all TAF1 proteins and peptides
  • Purity

    >= 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKII TRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQ SMLDLCDEKLKEKEDKLARLEKAINP
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1400 to 1518
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_004606

Specifications

Our Abpromise guarantee covers the use of ab198086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab198086 is useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.64% Tris HCl, 0.63% Sodium chloride, 20% Glycerol, 0.02% Potassium chloride

General Info

  • Alternative names

    • BA2R
    • CCG 1
    • CCG1
    • CCGS
    • Cell cycle G1 phase defect
    • Cell cycle gene 1 protein
    • Complementation of cell cycle block G1 to S
    • DYT3 protein
    • NSCL 2
    • NSCL2
    • OF
    • p250
    • TAF 1
    • TAF(II)250
    • TAF1 RNA polymerase II
    • TAF130
    • TAF145
    • TAF2A
    • TAFII 250
    • TAFII250
    • TATA box binding protein (TBP) associated factor RNA polymerase II A 250kD
    • TATA box binding protein (TBP)-associated factor
    • TBP associated factor 1
    • TBP associated factor 145 kDa
    • TBP associated factor 250 kDa
    • Transcription factor TFIID p250 polypeptide
    • Transcription initiation factor TFIID 250 kDa subunit
    • Transcription initiation factor TFIID subunit 1
    • YGR274C
    see all
  • Relevance

    TAF1 functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. Compared to higher eukaryotes TAF1, yeast TAF1 lacks the C-terminal bromodomains and C-terminal kinase activity. The TFIID interacting proteins BDF1 and BDF2 may substitute for these domains.
  • Cellular localization

    Nuclear

Images

  • 4-20% SDS PAGE analysis of ab198086 (1.9 μg).

References

ab198086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up