Description

  • Product name

    Recombinant human TAF1 protein
    See all TAF1 proteins and peptides
  • Biological activity

    ab198139 is incubated with biotinylated acetyl-histone peptide substrate in TAF1 assay buffer in a 10 µl reaction for 1 hour at RT. GSH acceptor beads were then added, and the mixture was incubated for 30 minutes at room temperature (RT). Streptavidin-conjugated donor beads were then added. After 10 minute incubation at RT, Alphacounts are measured.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQ TLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCD EKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPF HHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILAN SVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEE AE
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      1400 to 1651
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Isoform 2. NM_004606.4

Specifications

Our Abpromise guarantee covers the use of ab198139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 20% Glycerol, 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BA2R
    • CCG 1
    • CCG1
    • CCGS
    • Cell cycle G1 phase defect
    • Cell cycle gene 1 protein
    • Complementation of cell cycle block G1 to S
    • DYT3 protein
    • NSCL 2
    • NSCL2
    • OF
    • p250
    • TAF 1
    • TAF(II)250
    • TAF1 RNA polymerase II
    • TAF130
    • TAF145
    • TAF2A
    • TAFII 250
    • TAFII250
    • TATA box binding protein (TBP) associated factor RNA polymerase II A 250kD
    • TATA box binding protein (TBP)-associated factor
    • TBP associated factor 1
    • TBP associated factor 145 kDa
    • TBP associated factor 250 kDa
    • Transcription factor TFIID p250 polypeptide
    • Transcription initiation factor TFIID 250 kDa subunit
    • Transcription initiation factor TFIID subunit 1
    • YGR274C
    see all
  • Relevance

    TAF1 functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. Compared to higher eukaryotes TAF1, yeast TAF1 lacks the C-terminal bromodomains and C-terminal kinase activity. The TFIID interacting proteins BDF1 and BDF2 may substitute for these domains.
  • Cellular localization

    Nuclear

Images

  • Activity assay using ab198139

  • 10% SDS-PAGE Coomassie staining. 

    Lane 1: 0.72 µg ab198139
    Lane 2: Protein Marker

References

ab198139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up