Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKK IIF
    • Amino acids
      158 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC:15243
    • p30 beta
    • PRO2134
    • TAF
    • TAF(II)28
    • TAF11
    • TAF11 RNA polymerase II TATA box binding protein (TBP) associated factor 28 kD
    • TAF11_HUMAN
    • TAF2I
    • TAFII 28
    • TAFII-28
    • TAFII28
    • TFIID subunit p30 beta
    • TFIID subunit p30-beta
    • Transcription initiation factor TFIID 28 kDa subunit
    • Transcription initiation factor TFIID subunit 11
    see all
  • Function
    Core TAFII present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).
  • Sequence similarities
    Belongs to the TAF11 family.
  • Domain
    TBP and TAFII18 bind to distinct domains of TAFII28.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up