Description

  • Product name

    Recombinant Human TAF13 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPY TESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARV KDLLTMNEELKRARKAFDEANYGS
    • Amino acids

      1 to 124
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC22425
    • TAF(II)18
    • taf13
    • TAF13 RNA polymerase II, TATA box binding protein (TBP) associated factor, 18kDa
    • TAF13_HUMAN
    • TAF2K
    • TAFII 18
    • TAFII-18
    • TAFII18
    • Transcription initiation factor TFIID 18 kDa subunit
    • Transcription initiation factor TFIID subunit 13
    see all
  • Function

    TFIID beta-specific TAFII.
  • Sequence similarities

    Belongs to the TAF13 family.
    Contains 1 histone-fold domain.
  • Domain

    The binding of TAF10 and TAF11 requires distinct domains of TAF13.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159634 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up