Description

  • Product name

    Recombinant Human TAF1L protein
    See all TAF1L proteins and peptides
  • Purity

    >= 89 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDDDQVAFSFILDNIVT QKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRE SFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEK DICTAKEAALEEAE
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1517 to 1649
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Bromodomain 2; NM_153809.

Specifications

Our Abpromise guarantee covers the use of ab198128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

General Info

  • Alternative names

    • MGC134910
    • TAF 1L
    • TAF(II)210
    • TAF1 like RNA polymerase II TATA box binding protein (TBP) associated factor 210kD
    • TAF1 like RNA polymerase II TATA box binding protein (TBP) associated factor 210kDa
    • TAF1 RNA polymerase II TATA box binding protein (TBP) associated factor 210kDa like
    • TAF1L
    • TAF1L_HUMAN
    • TAF2A2
    • TBP associated factor 1 like
    • TBP associated factor 210 kDa
    • TBP associated factor RNA polymerase 1 like
    • TBP-associated factor 1-like
    • TBP-associated factor 210 kDa
    • Transcription initiation factor TFIID 210 kDa subunit
    • Transcription initiation factor TFIID subunit 1 like
    • Transcription initiation factor TFIID subunit 1-like
    see all
  • Function

    May act as a functional substitute for TAF1/TAFII250 during male meiosis, when sex chromosomes are transcriptionally silenced.
  • Tissue specificity

    Testis specific, expressed apparently in germ cells.
  • Sequence similarities

    Belongs to the TAF1 family.
    Contains 2 bromo domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198128 (1µg).

  • Activity assay using ab198128.

References

ab198128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up