Overview

  • Product name

    Recombinant Human TAF5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVD VTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERI MDEKTASE
    • Amino acids

      428 to 535
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • fc38g05
    • MGC123129
    • p85
    • TAF(II)100
    • TAF2D
    • TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
    • TAFII 80
    • TAFII100
    • TATA box binding protein (TBP)-associated factor 2D
    • TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD
    • TBP-associated factor, RNA polymerase II, 100-KD
    • Transcription initiation factor TFIID 100 kDa subunit
    • Transcription initiation factor TFIID 85 kDa subunit
    • Transcription initiation factor TFIID subunit 5
    • wu:fc38g05
    • zgc:123129
    see all
  • Relevance

    TAF5 is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in helping to anchor Taf4 within the TFIID complex. It may be involved in transducing signals from various transcriptional regulators to the RNA polymerase II transcription machinery. TAF5 belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (Tafs).
  • Cellular localization

    Nuclear

Images

  • ab159626 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up