Overview

  • Product name

    Recombinant Human TAF5L protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQS ESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLF VYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDIL SNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQ PAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVK DGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSK KLKSEPHQVDVSRIHLACDILEEEV
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 325

Specifications

Our Abpromise guarantee covers the use of ab132622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110005N04Rik
    • AI849020
    • OTTHUMP00000037470
    • OTTHUMP00000037471
    • PAF65 beta
    • PAF65-beta
    • PAF65B
    • PCAF associated factor 65 beta
    • PCAF-associated factor 65 beta
    • TAF 5L
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kD
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kDa
    • TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 5L
    • TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65kDa
    • TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
    • Taf5l
    • Taf5l protein
    • TAF5L_HUMAN
    see all
  • Function

    Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
  • Sequence similarities

    Belongs to the WD repeat TAF5 family.
    Contains 6 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132622 stained with Coomassie Blue.

References

ab132622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up