Description

  • Product name

    Recombinant Human TAF7 protein
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD GRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVST VD GDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKR RFRK TAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAEN QGLDIS SPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEE DINIIDTE EDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKG KLQETQDRAK RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSS LQEELESLLEK
    • Amino acids

      1 to 349

Specifications

Our Abpromise guarantee covers the use of ab91738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 76 µl aqua dest.

General Info

  • Alternative names

    • RNA polymerase II TBP-associated factor subunit F
    • TAF 7
    • TAF(II)55
    • TAF2F
    • TAF7
    • TAF7 RNA polymerase II
    • TAF7 RNA polymerase II TATA box binding protein (TBP) associated factor 55 kDa
    • TAF7_HUMAN
    • TAFII 55
    • TAFII-55
    • TAFII55
    • TATA box binding protein (TBP) associated factor RNA polymerase II F 55kD
    • TATA box binding protein associated factor 2F
    • TBP associated factor F
    • Transcription factor IID subunit TAFII55
    • Transcription initiation factor TFIID 55 kDa subunit
    • Transcription initiation factor TFIID subunit 7
    see all
  • Function

    Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the TAF7 family.
  • Domain

    The [KR]-[STA]-K motif is specifically recognized by the SETD7 methyltransferase, which methylates Lys-5 in vitro.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up