Overview

  • Product name
    Recombinant Human TAF7L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRW EVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRS NN
    • Amino acids
      231 to 332
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 40
    • CT40
    • FLJ23157
    • RNA polymerase II TBP-associated factor subunit Q
    • TAF2Q
    • TAF7 like RNA polymerase II, TATA box binding protein (TBP) associated factor
    • Taf7l
    • TAF7L_HUMAN
    • TATA box binding protein-associated factor, RNA polymerase II, Q
    • TATA box-binding protein-associated factor 50 kDa
    • TBP associated factor, RNA polymerase II, Q
    • Transcription initiation factor TFIID 50 kDa subunit
    • Transcription initiation factor TFIID subunit 7-like
    see all
  • Function
    Probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis.
  • Tissue specificity
    Testis-specific.
  • Sequence similarities
    Belongs to the TAF7 family.
  • Cellular localization
    Nucleus. Cytoplasm. Cytoplasmic in spermatogonia and early spermatocytes (preleptotene, leptotene, and zygotene); translocates into the nuclei of pachytene spermatocytes and round spermatids.
  • Information by UniProt

Images

  • ab162744 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up