Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVV CKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPV CLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPK ALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEV FEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPP LIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIA ATTGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTR SHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHC KMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDE NKSLSTYYQQCKKQLEVIRSQQQKRQGTS
    • Molecular weight

      89 kDa including tags
    • Amino acids

      1 to 579

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • M3K7_HUMAN
    • MAP3K 7
    • Map3k7
    • MEKK7
    • Mitogen activated protein kinase kinase kinase 7
    • Mitogen-activated protein kinase kinase kinase 7
    • TAK1
    • TGF beta activated kinase 1
    • TGF-beta-activated kinase 1
    • TGF1a
    • Transforming growth factor beta activated kinase 1
    • Transforming growth factor-beta-activated kinase 1
    see all
  • Function

    Component of a protein kinase signal transduction cascade. Mediator of TRAF6 and TGF-beta signal transduction. Activates IKBKB and MAPK8 in response to TRAF6 signaling. Stimulates NF-kappa-B activation and the p38 MAPK pathway. In osmotic stress signaling, plays a major role in the activation of MAPK8/JNK, but not that of NF-kappa-B.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Association with TAB1/MAP3K7IP1 promotes autophosphorylation and subsequent activation. Association with TAB2/MAP3K7IP2, itself associated with free unanchored Lys-63 polyubiquitin chain, promotes autophosphorylation and subsequent activation of MAP3K7. Dephosphorylation at Thr-187 by PP2A and PPP6C leads to inactivation.
    Ubiquitinated, leading to proteasomal degradation (By similarity). Requires 'Lys-63'-linked polyubiquitination for autophosphorylation and subsequent activation. 'Lys-63'-linked ubiquitination does not lead to proteasomal degradation. Deubiquitinated by CYLD, a protease that selectively cleaves 'Lys-63'-linked ubiquitin chains. Deubiquitinated by Y.enterocolitica YopP.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132950 stained with Coomassie Blue.
  • Kinase assay using ab132950 and [gamma 32P] ATP.
    Fig 1: SDS-PAGE gel
    Fig 2: Autoradiograph of SDS-PAGE gel

    Kinase substrates:
    H3 histone, family 3A - calf thymus - Molecular weight: approx. 16.5-17 kDa on SDS-PAGE
    Myelin basic protein - bovine brain - Molecular weight: approx. 21-22 kDa on SDS-PAGE
    Histone H1.0 - calf thymus - Molecular weight: approx. 32-33 kDa on SDS-PAGE
    Beta-casein protein - bovine milk - Molecular weight: approx. 33-34 kDa on SDS-PAGE

References

ab132950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up