Description

  • Product name

    Recombinant Human TAM41 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLD FVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSL IMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLR SALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTK VLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMT LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS SLKLHKMWKGWLRKTS
    • Amino acids

      1 to 316
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as C3ORF31.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C3ORF31
    • CDP-DAG synthase
    • CDP-diacylglycerol synthase
    • Chromosome 3 open reading frame 31
    • MGC16471
    • mitochondrial translocator assembly and maintenance protein 41 homolog
    • MMP37 like protein
    • MMP37 like protein mitochondrial
    • Phosphatidate cytidylyltransferase, mitochondrial
    • RAM41
    • TAM41
    • TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)
    • TAM41_HUMAN
    • TAMM41
    • translocator assembly and maintenance, mitochondrial, S. cerevisiae
    see all
  • Function

    Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.
  • Pathway

    Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
  • Sequence similarities

    Belongs to the TAM41 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab165356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up