Description

  • Product name

    Recombinant human Tankyrase 2/TNKS2 protein
    See all Tankyrase 2/TNKS2 proteins and peptides
  • Biological activity

    Specific Activity: ≥16259 U/µg.

    Unit Definition: One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form.

    Assay Conditions: Enzyme reaction is conducted using a Tankyrase 2/TNKS2 Histone Ribosylation Assay Kit (Biotin-labeled NAD+).

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPL HNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLA HGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVR SPGATADALSSGPSSPSSLSAASSLDNLSGSFSELSSVVSSSGTEGASSL EKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIG INAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQ SVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEV SEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSS KSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMA HSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG
    • Predicted molecular weight

      81 kDa including tags
    • Amino acids

      667 to 1166
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_025235.

Specifications

Our Abpromise guarantee covers the use of ab198755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Previously labelled as Tankyrase 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADP-ribosyltransferase diphtheria toxin-like 6
    • ARTD6
    • PARP 5b
    • PARP 5c
    • PARP-5b
    • PARP-5c
    • PARP5B
    • PARP5C
    • pART6
    • Poly [ADP ribose] polymerase 5B
    • Poly [ADP-ribose] polymerase 5B
    • TANK2
    • Tankyrase 2
    • Tankyrase II
    • Tankyrase like protein
    • Tankyrase related protein
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase 2
    • Tankyrase-2
    • Tankyrase-like protein
    • Tankyrase-related protein
    • TNKL
    • TNKS 2
    • TNKS-2
    • TNKS2
    • TNKS2_HUMAN
    • TRF1 Interacting Ankyrin Related ADP ribose polymerase 2
    • TRF1-interacting ankyrin-related ADP-ribose polymerase 2
    see all
  • Function

    Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles.
  • Tissue specificity

    Highly expressed in placenta, skeletal muscle, liver, brain, kidney, heart, thymus, spinal cord, lung, peripheral blood leukocytes, pancreas, lymph nodes, spleen, prostate, testis, ovary, small intestine, colon, mammary gland, breast and breast carcinoma, and in common-type meningioma. Highly expressed in fetal liver, heart and brain.
  • Sequence similarities

    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications

    Ubiquitinated at 'Lys-48' and 'Lys-63' by RNF146 when auto-poly-ADP-ribosylated; this leads to degradation.
    ADP-ribosylated (-auto). Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination.
    The crystallographic evidence suggests that the 3-hydroxyhistidine may be the (3S) stereoisomer.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Nucleus. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. Also found around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS2 is found in the nucleus, associated with TRF1.
  • Information by UniProt

Images

  • Activity assay using ab198755.

  • 4-20% SDS-PAGE analysis of 2.5 µg ab198755 with Coomassie staining.

References

ab198755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up