Description

  • Product name

    Recombinant human Tankyrase protein
  • Biological activity

    One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFH CVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI QKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQML FCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQA YPEYLITYQIMKPEAPSQTATAAEQKT
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      1001 to 1327
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.48% Tris buffer, 0.64% Sodium chloride, 0.017% Potassium chloride, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADP-ribosyltransferase diphtheria toxin-like 5
    • OTTHUMP00000115550
    • OTTHUMP00000224675
    • PARP 5a
    • PARP5A
    • PARPL
    • pART5
    • Poly [ADP-ribose] polymerase 5A
    • TANK 1
    • TANK1
    • Tankyrase 1
    • Tankyrase I
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase
    • Tankyrase-1
    • Tankyrase1
    • TankyraseI
    • TIN 1
    • TIN1
    • TINF 1
    • TINF1
    • TNKS
    • TNKS 1
    • TNKS-1
    • TNKS1
    • TNKS1_HUMAN
    • TRF1 interacting ankyrin related ADP ribose polymerase
    • TRF1-interacting ankyrin-related ADP-ribose polymerase
    see all
  • Function

    May regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
  • Tissue specificity

    Ubiquitous; highest levels in testis.
  • Sequence similarities

    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications

    Phosphorylated on serine residues by MAPK kinases upon insulin stimulation.
    ADP-ribosylated (-auto).
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Chromosome > centromere. Nucleus > nuclear pore complex. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. A minor proportion is also found at nuclear pore complexes and around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS is found in the nucleus, associated with TERF1.
  • Information by UniProt

Images

  • Specific activity of ab198639.

  • 4-20% SDS-PAGE with Coomassie staining

    Lane 1: 3.8 µg ab198639
    Lane 2: Protein marker

References

ab198639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up