Overview

  • Product name

    Recombinant Human TAP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRP GRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTAL PRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQ GWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAF VVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLF LVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE DTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFL LPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKF REKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVS SGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPP SGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQV FGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG SQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPE RYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMV QAPADAPE
    • Amino acids

      1 to 808
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABC 17
    • ABC transporter MHC 1
    • ABC17
    • ABCB 2
    • ABCB2
    • Antigen peptide transporter 1
    • APT 1
    • APT1
    • ATP binding cassette sub family B (MDR/TAP) member 2
    • ATP binding cassette sub family B member 2
    • ATP binding cassette transporter
    • ATP-binding cassette sub-family B member 2
    • D6S114E
    • FLJ26666
    • FLJ41500
    • Peptide supply factor 1
    • Peptide transporter involved in antigen processing 1
    • Peptide transporter PSF 1
    • Peptide transporter PSF1
    • Peptide transporter TAP 1
    • Peptide transporter TAP1
    • PSF 1
    • PSF-1
    • PSF1
    • Really interesting new gene 4 protein
    • RING 4
    • RING4
    • TAP 1
    • TAP1
    • TAP1*0102N
    • TAP1_HUMAN
    • TAP1N
    • Transporter 1 ATP binding cassette sub family B
    • Transporter 1 ATP binding cassette sub family B (MDR/TAP)
    • Transporter associated with antigen processing
    • Transporter ATP binding cassette major histocompatibility complex 1
    • Y3
    see all
  • Function

    Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules.
  • Involvement in disease

    Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1) [MIM:604571]; also called HLA class I deficiency. BLS1 is a class I antigen deficiency that is not accompanied by particular pathologic manifestations during the first years of life. Systemic infections have not been described. Chronic bacterial infections, often beginning in the first decade of life, are restricted to the respiratory tract.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Domain

    The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2.
  • Cellular localization

    Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane.
  • Information by UniProt

Images

  • ab159637 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up