Overview

  • Product name

    Recombinant Human TAP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW GLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWS WLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLP LLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFS FGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELN SRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM PFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEH EVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQ DGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQ PNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTA LVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVG QEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNS RGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
    • Molecular weight

      101 kDa including tags
    • Amino acids

      1 to 686

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABC transporter, MHC 2
    • ABC18
    • ABCB3
    • Antigen peptide transporter 2
    • APT2
    • ATP binding cassette, sub family B (MDR/TAP), member 3
    • ATP-binding cassette sub-family B member 3
    • D6S217E
    • Peptide supply factor 2
    • Peptide transporter involved in antigen processing 2
    • Peptide transporter PSF2
    • Peptide transporter TAP2
    • PSF 2
    • PSF-2
    • PSF2
    • Really interesting new gene 11 protein
    • RING 11
    • RING11
    • TAP 2
    • Tap2
    • TAP2_HUMAN
    • Transporter 2 ATP binding cassette sub family B
    • Transporter 2, ABC (ATP binding cassette
    • Transporter 2, ATP binding cassette, sub family B (MDR/TAP)
    see all
  • Function

    Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association.
  • Involvement in disease

    Bare lymphocyte syndrome 1
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Domain

    The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2.
  • Cellular localization

    Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132658 stained with Coomassie Blue

References

ab132658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up