Description

  • Product name

    Recombinant Human TAPP-1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLP SGSSRVGAIKLTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDL VEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVP IITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAGYCVK QGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSD IMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSASS EHPPGPSESKHAFRPTNAATATSHSTASRSNSLVSTFTMEKRGFYESLAK VKPGNFKVQTVSPREPASKVTEQALLRPQSKNGPQEKDCDLVDLDDASLP VSDV
    • Amino acids

      1 to 404
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • OTTHUMP00000020651
    • PH domain containing family A member 1
    • PH domain-containing family A member 1
    • PKHA1_HUMAN
    • Pleckstrin homology domain containing A1
    • Pleckstrin homology domain containing family A member 1
    • Pleckstrin homology domain containing, family A (phosphoinositide binding specific) member
    • Pleckstrin homology domain-containing family A member 1
    • PLEKHA1
    • Tandem PH domain containing protein 1
    • Tandem PH domain-containing protein 1
    • TAPP 1
    • TAPP-1
    • TAPP1
    see all
  • Function

    Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane.
  • Tissue specificity

    Highly expressed in skeletal muscle, thymus, pancreas, placenta and lung. Detected at low levels in brain, heart, peripheral blood leukocytes, testis, ovary, spinal cord, thyroid, kidney, liver, small intestine and colon.
  • Sequence similarities

    Contains 2 PH domains.
  • Domain

    Binds to membranes enriched in PtdIns3,4P2 via the C-terminal PH domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Nucleus. Locates to the plasma membrane after treatments that stimulate the production of PtdIns3,4P2.
  • Information by UniProt

Images

  • ab163705 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up