Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS
    • Molecular weight

      11 kDa
    • Amino acids

      24 to 94
    • Additional sequence information

      Mature full length protein with the signal peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab202781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by its ability to chemoattract Human T cells using a concentration range of 1.0-10.0 ng/ml.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 97 % SDS-PAGE.
    and HPLC analyses
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as TARC

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • A-152E5.3
    • A152E53
    • ABCD 2
    • ABCD2
    • C-C motif chemokine 17
    • CC chemokine TARC
    • CCL17
    • CCL17_HUMAN
    • Chemokine CC Motif Ligand 17
    • MGC138271
    • MGC138273
    • SCYA17
    • Small Inducible Cytokine A17
    • Small Inducible Cytokine A17 Precursor
    • Small Inducible Cytokine Subfamily A (Cys Cys)
    • Small Inducible Cytokine Subfamily A (Cys Cys) Member 17
    • Small-inducible cytokine A17
    • T Cell Directed CC Chemokine
    • Thymus and activation regulated chemokine
    • Thymus and activation-regulated chemokine
    see all
  • Function

    Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.
  • Tissue specificity

    Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up