Description

  • Product name

    Recombinant Human Tartrate Resistant Acid Phosphatase protein
    See all Tartrate Resistant Acid Phosphatase proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab206785 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLGD NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQI AYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQ PERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLV KQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQ RKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPR RARPHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      22 to 325
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form of Tartrate Resistant Acid Phosphatase without signal peptide. NP_001104505

Specifications

Our Abpromise guarantee covers the use of ab206785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Type 5 acid phosphatase
    • Acid phosphatase 5 tartrate resistant
    • Acid phosphatase 5, tartrate resistant
    • ACP5
    • EC 3.1.3.2
    • MGC117378
    • PPA5_HUMAN
    • serum band 5 tartrate-resistant acid phosphatase
    • SPENCDI
    • T5ap
    • Tartrate resistant acid ATPase
    • Tartrate resistant acid phosphatase type 5
    • Tartrate resistant acid phosphatase type 5 precursor
    • Tartrate-resistant acid ATPase
    • Tartrate-resistant acid phosphatase type 5
    • TR AP
    • TR-AP
    • TRACP 5
    • TRAP
    • TrATPase
    • Type 5 acid phosphatase
    see all
  • Function

    Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similarities

    Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg of ab206785.

References

ab206785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up