Overview

  • Product name

    Recombinant Human TAS2R9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILIS LAISRICLLCVISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFT SCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLISLIISVPKND DMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFL LLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLLLIVYYPVFLV MTSSALIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFV KCFLRRRKPFVP
    • Amino acids

      1 to 312
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • T2R9
    • Taste receptor, family B, member 6
    • Taste receptor, type 2, member 9
    • TRB6
  • Relevance

    TAS2R9 belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. TAS2R9 is implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium regulated cation channel TRPM5.
  • Cellular localization

    Membrane; Multipass membrane protein.

Images

  • ab162364 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up