Recombinant Human Taspase-1 protein (ab163149)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGA GYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTN AGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVANRLLCEG QKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNK RKLELAERVDTDFMQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAV SSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRT ILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCR CSAEPDSSQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGA VAGQSVAIEGGVCRLESPVN
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf13
    • dJ585I14.2
    • FLJ20212
    • MGC39159
    • TASP 1
    • Tasp1
    • TASP1_HUMAN
    • Taspase 1
    • Taspase threonine aspartase 1
    • Taspase-1
    • Taspase1
    • Threonine aspartase 1
    • Threonine aspartase subunit beta
    see all
  • Function
    Protease involved in MLL processing and, consequently, in the correct expression of the early HOXA gene cluster.
  • Sequence similarities
    Belongs to the Ntn-hydrolase family.
  • Information by UniProt

Images

  • ab163149 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up