Description

  • Product name

    Recombinant Human Tau410 protein
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK SRLQTAPV PMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIH HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFR ENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLA DEVSASLAKQGL
    • Amino acids

      1 to 410
    • Additional sequence information

      This is full length isoform P10636-5, Tau-C.

Specifications

Our Abpromise guarantee covers the use of ab72462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    This protein is full-length isoform 5, Isoform Tau-C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 25% Glycerol, 0.87% Sodium chloride

General Info

  • Alternative names

    • DDPAC
    • FLJ31424
    • FTDP 17
    • FTDP17
    • G protein beta1/gamma2 subunit interacting factor 1
    • MAPT
    • MAPTL
    • MGC138549
    • Microtubuleassociated protein tau
    • MSTD
    • MTBT1
    • MTBT2
    • Neurofibrillary tangle protein
    • Paired helical filament tau
    • PHF tau
    • PPND
    • TAU
    see all
  • Relevance

    Tau410 or Tau C is a member of the Tau family of proteins. Tau proteins promote microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
  • Cellular localization

    Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, axon. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

Images

  • SDS-PAGE showing ab72462 at approximately 61kDa.

References

ab72462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Question
Answer

Ab72461: Tau D (383 amino acids long) Ab72462: Tau C (410 amino acids long) Ab72463: Tau E (412 amino acids long) Ab72489: Tau F, only amino acids 1-391

Read More

Question
Answer

The isoform of ab72462 is the 410 kDa tau protein, also known as Tau-C according to uniProt:
http://www.uniprot.org/uniprot/P10636

Read More

Question
Answer

Thank you for contacting us.

The link to the UniProt database entry is as follows:
http://pir.uniprot.org/uniprot/P10636

ab72462: P10636-5 corresponds to Tau-3

ab72489: P10636-8 corresponds to Tau-4


If you decide to try any of these proteins in ELISA, you could use our Abtrial program. For UNTESTED species and/or applications, we have established a testing discount program. Here is a brief description of how it works:

The testing discount program is for customers who like to use an antibody/protein/kit on an untested species/application. You would purchase the to-be-tested product at full price, test it and submit an Abreview with your data (positive or negative). On your next order you will receive a discount in the amount of the price you paid for the to-be-tested product. The terms and conditions applicable to this offer can be found here: https://www.abcam.com/abtrial.


I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up