Description

  • Product name

    Recombinant Human Tau412 protein
    See all Tau412 proteins and peptides
  • Biological activity

    Isoform Tau E
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPG SETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARM VSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKT PPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSR SRTPSLPTPPTREP KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PG GGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK CGSLGNIH HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK KIETHKLTFRENAKAKTDHG AEIVYKSPVVSGDTSPRHLSNVSSTGSI DMVDSPQLATLADEVSASLAKQGL
    • Amino acids

      1 to 412

Associated products

Specifications

Our Abpromise guarantee covers the use of ab84763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Isoform Tau E
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 25% Glycerol, 0.87% Sodium chloride

General Info

  • Alternative names

    • DDPAC
    • FTDP 17
    • FTDP17
    • G protein beta1/gamma2 subunit interacting factor 1
    • MAPTL
    • Microtubule associated protein tau, isoform 4
    • MSTD
    • MTBT1
    • MTBT2
    • Neurofibrillary tangle protein
    • Paired helical filament tau
    • PHF tau
    • TAU
    see all
  • Relevance

    Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. There are nine named isoforms. Defects in Tau are a cause of frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP17) [MIM:600274, 172700], pallido-ponto-nigral degeneration (PPND) [MIM:168610], corticobasal degeneration (CBD), progressive supranuclear palsy (PSP) [MIM:601104, 260540], hereditary dysphasic disinhibition dementia (HDDD) [MIM:607485].
  • Cellular localization

    Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cell projection, axon. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

Images

  • ab84763 by SDS-Page

References

ab84763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up