Recombinant Human TBC1D13 protein (ab171599)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSSLHKSRIADFQDVLKEPSIALEKLR ELSFSGIPCEGGLRCLCWKILLNYLPLERASWTSILAKQRELYAQFLREM IIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVLLQIDKDV RRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRS GVTNMSSPHKNSVPSSLNEYEVLPNGCEAHWEVVERILFIYAKLNPGIAY VQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSL DDSQCGITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAFRWLTLLLSQ EFLLPDVIRIWDSLFADDNRFDFLLLVCCAMLMLIREQLLEGDFTVNMRL LQDYPITDVCQILQKAKELQDSK
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 400
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab171599 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Information available upon request.

General Info

  • Alternative names
    • 2600014A06Rik
    • BC025586
    • FLJ10743
    • MGC38260
    • OTTHUMP00000022298
    • OTTMUSP00000018144
    • RP11 545E17.5
    • RP23 315H12.1
    • TBC1 domain family member 13
    see all
  • Relevance
    TBC1D13 may act as a GTPase-activating protein for Rab family protein(s). It contains 1 Rab-GAP TBC domain.
  • Cellular localization
    Intracellular

Images

  • 15% SDS-PAGE analysis of 3µg ab171599.

References

ab171599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up