Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQWNSMPRLPTDLDVEGPWFRHYDFRQSCWVRAISQEDQLAPCWQAEHPA ERVRSAFAAPSTDSDQGTPFRARDEQQCAPTSGPCLCGLHLESSQFPPGF
    • Amino acids
      450 to 549
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PRC17
    • TBC1 domain family member 3
    • TBC1 domain family member 3F
    • TBC1D3
    • TBC1D3F
    • TBC3F_HUMAN
    • TRE17
    • TRE17 alpha protein
    see all
  • Function
    Acts as a GTPase activating protein for RAB5. Does not act on RAB4 or RAB11.
  • Tissue specificity
    Expressed in most tissues including pancreas, thymus and testis.
  • Sequence similarities
    Contains 1 Rab-GAP TBC domain.
  • Information by UniProt

Images

  • ab164526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up