Description

  • Product name

    Recombinant Human TBCC protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQ EVEKENSHFFVATFARERAAVEELLERAESVERLEEAASRLQGLQKLIND SVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASST KVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCS DCVLAVACQQLRIHSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEID KDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 346

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta tubulin cofactor C
    • CFC
    • TBCC
    • TBCC_HUMAN
    • Tubulin folding cofactor C
    • Tubulin specific chaperone c
    • Tubulin-folding cofactor C
    • Tubulin-specific chaperone C
    see all
  • Function

    Tubulin-folding protein; involved in the final step of the tubulin folding pathway.
  • Tissue specificity

    Expressed in the retina. Expressed in the rod and cone photoreceptors, extending from the inner segments (IS), through the outer nuclear layer (ONL) and into the synapses in the outer plexiform layer (OPL). Strongly expressed to the photoreceptor connecting cilium at the tips of the IS (at protein level).
  • Sequence similarities

    Belongs to the TBCC family.
    Contains 1 C-CAP/cofactor C-like domain.
  • Cellular localization

    Cytoplasm. Detected predominantly in the photoreceptor connecting cilium.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116845 at approximately 64.17 kDa.

References

ab116845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up