Overview

  • Product name

    Recombinant Human TBCD/SSD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKISHWDGVIRELAARALHNLAQQAPEFSATQVFPRLLSMTLSPDLHTRH GSILACAEVAYALYKLAAQENRPVTDHLDEQAVQGLKQIHQQLYDRQLYR GLGGQLMRQAVCVLIEKLSLSKMPFRGDTVIDGWQWLINDTLRHLHLISS HSRQQMKDAAVSALAALCSEYYMKEPGEADPAIQEELITQYLAELRNPEE MTRCGFSLALGALPGFLLKGRLQQVLTGLRAVTHTSPEDVSFAESRRDGL KAIARICQTVGVKAGAPDEAVCGENVSQIYCALLGCMDDYTTDSRGDVGT WVRKAAMTSLMDLTLLLARSQPELIEAHTCERIMCCVAQQASEKIDRFRA HAASVFLTLLHFDSPPIPHVPHRGELEKLFPRSDVASVNWSAPSQAFPRI TQLLGLPTYRYHVLLGLVVSLGGLTESTIRHSTQSLFEYMKGIQSDPQAL GSFSGTLLQIFEDNLLNERVSVPLLKTLDHVLTHGCFDIFTTEEDHPFAV KLLALCKKEIKNSKDIQKLLSGIAVFCGMVQFPGDVRRQALLQLCLLLCH RFPLIRKTTASQVYETLLTYSDVVGADVLDEVVTVLSDTAWDAELAVVRE QRNRLCDLLGVPRPQLVPQPGAC
    • Amino acids

      1 to 623
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TBCD

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta tubulin cofactor D
    • Beta-tubulin cofactor D
    • KIAA0988
    • SSD 1
    • SSD-1
    • SSD1
    • tbcd
    • TBCD_HUMAN
    • tfcD
    • Tubulin folding cofactor D
    • Tubulin specific chaperone D
    • Tubulin-folding cofactor D
    • Tubulin-specific chaperone D
    see all
  • Function

    Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Acts as a GTPase-activating protein (GAP) for ARL2. Its ability to interact with beta tubulin is regulated via its interaction with ARL2. Induces microtubule disruption in absence of ARL2. Increases degradation of beta tubulin, when overexpressed in polarized cells. Promotes epithelial cell detachment, a process antagonized by ARL2. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the TBCD family.
    Contains 3 HEAT repeats.
  • Cellular localization

    Cell junction > tight junction. Lateral cell membrane. Cytoplasm. Cell junction > adherens junction. Localized in cell-cell contacts.
  • Information by UniProt

Images

  • ab159639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up