Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALI SILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFR EKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENR AHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGS GDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGT LLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDK TTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGC DRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQEVCIHDLQ AHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCTHTL TKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFE VCWNARGDKVGASASDGSVCVLDLRK
    • Molecular weight

      83 kDa including tags
    • Amino acids

      1 to 526
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • EBI
    • F box like/WD repeat protein TBL1X
    • F-box-like/WD repeat-containing protein TBL1X
    • SMAP 55
    • SMAP55
    • TBL 1
    • TBL 1X
    • TBL1
    • TBL1X
    • TBL1X_HUMAN
    • Transducin (beta) like 1
    • Transducin (beta) like 1 X linked
    • Transducin (beta) like 1X linked
    • Transducin beta like 1 X linked
    • Transducin beta like 1X
    • Transducin beta like 1X protein
    • Transducin beta like protein 1, X linked
    • Transducin beta-like protein 1X
    • Transducin-beta-like protein 1
    • X-linked
    see all
  • Function

    F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the WD repeat EBI family.
    Contains 1 F-box-like domain.
    Contains 1 LisH domain.
    Contains 8 WD repeats.
  • Domain

    The F-box-like domain is related to the F-box domain, and apparently displays the same function as component of ubiquitin E3 ligase complexes.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131841 at approximately 83.4 kDa.

References

ab131841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer


The full sequence for ab131841, including GST tag and linker is below.

MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLETSLYKKAGT

MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up