Overview

  • Product name

    Recombinant Human TBRG1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVWPALWELYRELGLFQGPALGLRNHLGRKLRRRKKKKAKRTTNWKIITD RPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVP EDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPAI HNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQ IFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSP SQGSPIQSSD
    • Amino acids

      1 to 260
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • NIAM
    • Nuclear interactor of ARF and Mdm2
    • TB 5
    • tbrg1
    • TBRG1 regulator 1
    • TBRG1_HUMAN
    • Transforming growth factor beta regulator 1
    see all
  • Relevance

    Function: Acts as a growth inhibitor. Can activate p53/TP53, causes G1 arrest and collaborates with CDKN2A to restrict proliferation, but does not require either protein to inhibit DNA synthesis. Redistributes CDKN2A into the nucleoplasm. Involved in maintaining chromosomal stability. Tissue specificity: Widely expressed at low levels in most tissues, with highest levels in pancreas, lung and liver. Expression is decreased in primary tumors including lung, liver, breast, pancreas and kidney carcinomas, chronic lymphocytic leukemia and diffuse large B-cell lymphoma. Similarity: Belongs to the TBRG1 family. Contains 1 FYR C-terminal domain. Contains 1 FYR N-terminal domain. PTM: Ubiquitinated; mediated by MDM2 and leading to its subsequent proteasomal degradation.
  • Cellular localization

    Nuclear

Images

  • ab164683 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up