Description

  • Product name

    Recombinant Human Tbx20 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS CAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKI ACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLM DIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQM VSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEE FRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIER
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 297

Specifications

Our Abpromise guarantee covers the use of ab132480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • T-box 20
    • T-box protein 20
    • T-box transcription factor TBX20
    • Tbox 20
    • tbx20
    • TBX20_HUMAN
    see all
  • Function

    Probable transcriptional regulator involved in developmental processes.
  • Involvement in disease

    Defects in TBX20 are the cause of atrial septal defect type 4 (ASD4) [MIM:611363]. ASD4 is a congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria. ASD4 patients show other heart abnormalities including defects in septation, chamber growth and valvulogenesis. ASD4 is not associated with defects in the cardiac conduction system or with non-cardiac abnormalities.
  • Sequence similarities

    Contains 1 T-box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132480 stained with Coomassie Blue

References

ab132480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up