Description

  • Product name

    Recombinant Human TBX22 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSS AAGKSEPLEKQPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSE LWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHVAIDVVPVDSK RYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMK LTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFS FKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPW RPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHL PTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSS QSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSP GNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQV SFGEGKCNHVHWYPAINHYL
    • Amino acids

      1 to 520
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABERS
    • CLPA
    • CPX
    • D230020M15Rik
    • dJ795G23.1
    • T box 22
    • T box protein 22
    • T box transcription factor TBX22
    • T-box protein 22
    • T-box transcription factor TBX22
    • Tbx22
    • TBX22_HUMAN
    • TBXX
    see all
  • Function

    Probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis.
  • Tissue specificity

    Seems to be expressed at a low level.
  • Involvement in disease

    Defects in TBX22 are the cause of X-linked cleft palate with ankyloglossia (CPX) [MIM:303400].
  • Sequence similarities

    Contains 1 T-box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162381 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up