Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFR FPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKL RGPEPAATE
    • Amino acids

      191 to 299
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DFNB 67
    • DFNB67
    • SCDO5
    • T box 6
    • T box protein 6
    • T box transcription factor TBX 6
    • T box transcription factor TBX6
    • T-box protein 6
    • T-box transcription factor TBX6
    • Tbox 6
    • TBX 6
    • tbx6
    • TBX6_HUMAN
    see all
  • Function

    Probable transcriptional regulator involved in developmental processes. Could be required for specification of paraxial mesoderm structures during gastrulation.
  • Tissue specificity

    Expressed in fetal tail bud, posterior spinal tissue, intervertebral disk and testis. Also expressed in adult testis, kidney, lung, muscle and thymus.
  • Sequence similarities

    Contains 1 T-box DNA-binding domain.
  • Developmental stage

    Expressed during gastrulation and during a second phase in some adult tissues.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159643 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up