Overview

  • Product name
    Recombinant Human TC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIP LNMEEPPVEEPEPKPDRLLVLKVLWND
    • Amino acids
      209 to 285
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as SLC19A2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • S19A2_HUMAN
    • SLC19A2
    • Solute carrier family 19 member 2
    • TC1
    • Thiamine carrier 1
    • Thiamine transporter 1
    • THT1
    • ThTr 1
    • ThTr-1
    • ThTr1
    • TRMA
    see all
  • Function
    High-affinity transporter for the intake of thiamine.
  • Tissue specificity
    Ubiquitous; most abundant in skeletal and cardiac muscle. Medium expression in placenta, heart, liver and kidney, low in lung.
  • Involvement in disease
    Thiamine-responsive megaloblastic anemia syndrome
  • Sequence similarities
    Belongs to the reduced folate carrier (RFC) transporter (TC 2.A.48) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161045 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up