Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPS SGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQC PPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTW RCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMG PPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLL SWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
    • Amino acids
      1 to 282
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CD320. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8D6
    • 8D6 antigen
    • 8D6A
    • CD320
    • CD320 antigen
    • CD320_HUMAN
    • FDC-signaling molecule 8D6
    • FDC-SM-8D6
    • TCblR
    • Transcobalamin receptor
    see all
  • Function
    Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.
  • Tissue specificity
    Expressed abundantly on follicular dendritic cells (FDCs).
  • Involvement in disease
    Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC) [MIM:613646]; also called methylmalonic aciduria due to transcobalamin receptor defect. MMATC is a metabolic disorder characterized by increased blood C3-acylcarnitine levels, elevated methylmalonate and homocysteine, and low uptake of transcobalamin-bound cobalamin, but normal conversion to adenosylcobalamin and methylcobalamin. Plasma vitamin B12 and total homocysteine are normal.
  • Sequence similarities
    Contains 2 LDL-receptor class A domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162495 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up