Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENT GKRVEEPLKDKEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRA EGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKRKTNKGLAQYL KQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQD PFYPRGPREFRGGCRAPRRDTEDIPYV
    • Amino acids
      1 to 227
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • my048
    • MY0876G05
    • TCEA like protein 2
    • TCEAL 2
    • transcription elongation factor A (SII) like 2
    • Transcription elongation factor A like 2
    • Transcription elongation factor A protein like 2
    • Transcription elongation factor S II protein like 2
    • WEX1
    see all
  • Relevance
    TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
  • Cellular localization
    Nuclear

Images

  • ab165463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up