Recombinant Human TCEAL3/5/6 protein (ab166283)

Overview

  • Product name
    Recombinant Human TCEAL3/5/6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTEC EGKREDEGEPGDEGQLEDEGNQEKQGKSEGEDKPQSEGKPASQAKPESQP RAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECG DVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDL EDVPYV
    • Amino acids
      1 to 206
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1100001D19Rik
    • 1500026B10Rik
    • 6430401A05Rik
    • GHc-351F8.2
    • LL0XNC01-177E8.1
    • MGC107171
    • MGC15737
    • RGD1562504
    • RP23-132M9.2
    • RP23-197O15.1
    • RP23-460B8.1
    • RP5-1055C14.5
    • TCAL3_HUMAN
    • TCEA-like protein 3
    • TCEA-like protein 5
    • TCEAL3
    • TCEAL5
    • TCEAL6
    • Transcription elongation factor A protein like 3
    • Transcription elongation factor A protein like 5
    • Transcription elongation factor A protein like 6
    • Transcription elongation factor A protein-like 3
    • Transcription elongation factor S-II protein-like 3
    see all
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the TFS-II family. TFA subfamily.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab166283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up