Recombinant Human TCF-4/TCF7L2 protein (ab159648)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human TCF-4/TCF7L2 protein -
Expression system
Wheat germ -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN ESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPY PGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQAGSLQSRQALK DARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPAD VDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWQGQPVYPITTGGFR HPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSD VGSLHSSKHQDSKKEEEKKKPHIKKPPNAFMLYMKEMRAKVVAECTLKES AAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK KRKRDKQPGETNEHSECFLNPCLSLPPITGEKKSAFATYKVKAAASAHPL QMEAY -
Amino acids
1 to 455 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159648 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- HMG box transcription factor 4
- hTCF 4
- hTCF-4
see all -
Function
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. -
Tissue specificity
Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom. -
Involvement in disease
Note=Constitutive activation and subsequent transactivation of target genes may lead to the maintenance of stem-cell characteristics (cycling and longevity) in cells that should normally undergo terminal differentiation and constitute the primary transforming event in colorectal cancer (CRC).
Genetic variations in TCF7L2 are associated with susceptibility to non-insulin-dependent diabetes mellitus (NIDDM) [MIM:125853]. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance. -
Sequence similarities
Belongs to the TCF/LEF family.
Contains 1 HMG box DNA-binding domain. -
Developmental stage
Highly expressed in crypt regions and barely detectable in villi in epithelium from fetal small intestine at week 16. At week 22 expression in villi had increased strongly. -
Domain
The promoter-specific activation domain interacts with the transcriptional coactivator EP300. -
Post-translational
modificationsIn vitro, phosphorylated by TNIK.
Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylated by AXAM/SENP2. Sumoylation/desumoylation regulates TCF4 transcription activity in the Wnt signaling pathway without altering interaction with CTNNB1 nor binding DNA. -
Cellular localization
Nucleus > PML body. Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab159648 has not yet been referenced specifically in any publications.