Recombinant Human TCF7L1 protein (ab164388)

Overview

  • Product name
    Recombinant Human TCF7L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQ PPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKS
    • Amino acids
      489 to 586
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHb21
    • HMG box transcription factor
    • HMG box transcription factor 3
    • OTTMUSP00000023419
    • T cell factor 3
    • TCF 3
    • TCF-3
    • TCF3
    • Tcf7l1
    • TF7L1_HUMAN
    • Transcription factor 7 like 1
    • Transcription factor 7 like 1 (T-cell specific, HMG-box)
    • Transcription factor 7-like 1
    see all
  • Function
    Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis (By similarity). Down-regulates NQO1, leading to increased mitomycin c resistance.
  • Tissue specificity
    Detected in hair follicles and skin keratinocytes, and at lower levels in stomach epithelium.
  • Sequence similarities
    Belongs to the TCF/LEF family.
    Contains 1 HMG box DNA-binding domain.
  • Domain
    The putative Groucho interaction domain between the N-terminal CTNNB1 binding domain and the HMG-box is necessary for repression of the transactivation mediated by TCF7L1 and CTNNB1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164388 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up