Overview

  • Product name
    Recombinant Human TCFL5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFC GKTGRRLKLTRPDSLVTCPAQGSLQSSPSMEIK
    • Amino acids
      418 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe82
    • CHA
    • Cha transcription factor
    • E2BP-1
    • E2BP1
    • Figlb
    • HPV-16 E2-binding protein 1
    • MGC46135
    • TCFL 5
    • TCFL5
    • TCFL5_HUMAN
    • transcription factor-like 5 (basic helix-loop-helix)
    • Transcription factor-like 5 protein
    see all
  • Function
    Putative transcription factor. Isoform 3 may play a role in early spermatogenesis.
  • Tissue specificity
    Isoform 3 is testis specific. Isoform 2 is pancreas specific.
  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Developmental stage
    Isoform 3 is specifically expressed in primary spermatocytes at the pachytene stage, but not those at leptonema stage. Not expressed in other testicular cells, including spermatogonia located in the basal compartment of the seminiferous tubule or spermatids.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161125 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up