Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFV AGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
    • Amino acids
      121 to 220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • a3
    • Atp 6i
    • Atp6i
    • ATP6N1C
    • ATP6V0A3
    • ATPase H+ transporting 116kD
    • OC 116
    • OC 116 kDa
    • OC 116kDa
    • OC-116 kDa
    • OC116
    • OPTB 1
    • OPTB1
    • Osteoclastic proton pump 116 kDa subunit
    • Specific 116 kDa vacuolar proton pump subunit
    • Stv 1
    • Stv1
    • T cell immune regulator 1
    • T cell immune regulator 1 ATPase H+ transporting lysosomal V0 subunit A
    • T cell immune regulator 1 ATPase H+ transporting lysosomal V0 subunit A3
    • T cell immune response cDNA 7
    • T cell immune response cDNA7 protein
    • T cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
    • T-cell immune regulator 1
    • T-cell immune response cDNA7 protein
    • TCIRG 1
    • TCIRG1
    • TIRC 7
    • TIRC7
    • V ATPase 116 kDa
    • V ATPase 116 kDa isoform a3
    • V type proton ATPase 116 kDa subunit a
    • V-ATPase 116 kDa isoform a3
    • V-type proton ATPase 116 kDa subunit a isoform 3
    • Vacuolar proton translocating ATPase 116 kDa subunit A
    • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
    • Vph 1
    • Vph1
    • VPP3_HUMAN
    see all
  • Function
    Part of the proton channel of V-ATPases (By similarity). Seems to be directly involved in T-cell activation.
  • Tissue specificity
    Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus.
  • Involvement in disease
    Defects in TCIRG1 are the cause of osteopetrosis autosomal recessive type 1 (OPTB1) [MIM:259700]; also called autosomal recessive Albers-Schonberg disease or infantile malignant osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. The features of OPTB1 are macrocephaly, progressive deafness and blindness, hepatosplenomegaly, and severe anemia beginning in early infancy or in fetal life. Deafness and blindness are generally thought to represent effects of pressure on nerves.
  • Sequence similarities
    Belongs to the V-ATPase 116 kDa subunit family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160940 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up