Overview

  • Product name

    Recombinant Human TCN1 protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQ KMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLE NKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPE NKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKS LVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVL TEISQGAFSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPI TVTPPDSQSYISVNYSVRINETYFTNVTVLNGSVFLSVMEKAQKMNDTIF GFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVVRNG ENLEVRWSKY
    • Molecular weight

      62 kDa including tags
    • Amino acids

      24 to 433
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 433. The signal peptide is not included. N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab236331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Haptocorin
    • Haptocorrin
    • HC
    • OTTHUMP00000235879
    • TC 1
    • TC I
    • TC-1
    • TC1
    • TCI
    • TCN 1
    • TCN1
    • TCO1_HUMAN
    • Transcobalamin 1
    • Transcobalamin I
    • Transcobalamin-1
    • Transcobalamin1
    • TranscobalaminI
    • Vitamin B12 binding protein
    • Vitamin B12 binding protein R binder family
    see all
  • Function

    Vitamin B12-binding protein. Transports cobalamin into cells.
  • Tissue specificity

    Neutrophil granule protein.
  • Sequence similarities

    Belongs to the eukaryotic cobalamin transport proteins family.
  • Post-translational
    modifications

    Contains about 30% carbohydrates.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236331.

References

ab236331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up