Recombinant Human TCR V delta 1 protein (ab159659)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human TCR V delta 1 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHST DFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR -
Amino acids
173 to 272 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159659 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- T cell antigen receptor delta polypeptide
- T cell receptor delta (V,D,J,C)
- T cell receptor delta locus
see all -
Relevance
Two distinct types of T cell antigen receptors have been identified: the alpha/beta heterodimer found on functional helper and cytotoxic T cells, and the gamma/delta heterodimer. The latter is first detected approximately 2 days before the appearance of cell surface alpha/beta heterodimer during T cell ontogeny. In adult thymus it is found mainly in the least mature cells. The gene shows systematic rearrangement in early thymocytes and appears to use V gene segments of the TCR alpha chain family, well before any C(alpha) message of protein is detected. RNA from this locus is expressed at a high level in early thymocytes and adult 'double-negative' cells, but not in mature T cell populations.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab159659 has not yet been referenced specifically in any publications.