Recombinant Human TCR V delta 1 protein (ab159659)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human TCR V delta 1 protein
-
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHST DFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR
-
Amino acids173 to 272
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159659 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- T cell antigen receptor delta polypeptide
- T cell receptor delta (V,D,J,C)
- T cell receptor delta locus
see all -
RelevanceTwo distinct types of T cell antigen receptors have been identified: the alpha/beta heterodimer found on functional helper and cytotoxic T cells, and the gamma/delta heterodimer. The latter is first detected approximately 2 days before the appearance of cell surface alpha/beta heterodimer during T cell ontogeny. In adult thymus it is found mainly in the least mature cells. The gene shows systematic rearrangement in early thymocytes and appears to use V gene segments of the TCR alpha chain family, well before any C(alpha) message of protein is detected. RNA from this locus is expressed at a high level in early thymocytes and adult 'double-negative' cells, but not in mature T cell populations.
Images
Datasheets and documents
References
ab159659 has not yet been referenced specifically in any publications.