Description

  • Product name

    Recombinant Human TCTE3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFI IKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE
    • Amino acids

      99 to 198
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • t complex associated testis expressed 3
    • T-complex testis-specific protein 3
    • T-complex-associated testis-expressed protein 3
    • TC1D3_HUMAN
    • tcte 3
    • Tcte-3
    • TCTE3
    • Tctex1 domain containing 3
    • Tctex1 domain-containing protein 3
    • TCTEX1D3
    see all
  • Function

    May be an accessory component of axonemal dynein and cytoplasmic dynein 1. Candidate for involvement in male sterility.
  • Tissue specificity

    Expressed predominantly in testis. Also expressed in brain, lung and trachea.
  • Sequence similarities

    Belongs to the dynein light chain Tctex-type family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasmic granule. Membrane. Found on the surface of sperm tail. Stored in cytoplasmic granules during spermatogenesis.
  • Information by UniProt

Images

  • ab159662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up