Description

  • Product name

    Recombinant Human TDG protein (denatured)
    See all TDG proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEAENAGSYSLQQAQAFYTFPFQQLMA EAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPK KPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDI LTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMD DHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIA VFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCA QFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKM AVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSG IPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 410
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Thymine DNA glycosylase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • C JUN leucine zipper interactive protein
    • C-JUN leucine zipper interactive protein JZA-3
    • E130317C12Rik
    • EC 3.2.2.29
    • G/T mismatch specific thymine DNA glycosylase
    • G/T mismatch-specific thymine DNA glycosylase
    • JZA 3
    • Jza1
    • T:G mismatch thymine glycosylase
    • Tdg
    • TDG_HUMAN
    • Thymine DNA glycosylase
    • Thymine-DNA glycosylase
    see all
  • Function

    In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine.
  • Sequence similarities

    Belongs to the TDG/mug DNA glycosylase family.
  • Post-translational
    modifications

    Sumoylation on Lys-330 by either SUMO1 or SUMO2 induces dissociation of the product DNA.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134525.

References

ab134525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up