Description

  • Product name

    Recombinant Human TDO2/TDO protein
    See all TDO2/TDO proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK VLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNG HVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPA SGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKT LLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEK EEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYF SSDESD
    • Predicted molecular weight

      48 kDa
    • Amino acids

      1 to 406
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005651.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TDO2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • 3-dioxygenase
    • T23O_HUMAN
    • TDO
    • TDO 2
    • tdo2
    • TO
    • TPH2
    • TRPO
    • Tryptamin 2
    • Tryptamin 2 3 dioxygenase
    • Tryptophan 2
    • Tryptophan 2 3 dioxygenase
    • Tryptophan oxygenase
    • Tryptophan pyrrolase
    • Tryptophanase
    see all
  • Function

    Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin.
  • Pathway

    Amino-acid degradation; L-tryptophan degradation via kynurenine pathway; L-kynurenine from L-tryptophan: step 1/2.
  • Sequence similarities

    Belongs to the tryptophan 2,3-dioxygenase family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab204162.

References

ab204162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up